Bacterial taxon 431947
Locus PGN_1099
Protein WP_012458027.1
metallophosphoesterase
Porphyromonas gingivalis ATCC 33277
Length 164 aa, Gene n/a, UniProt B2RJS3
>WP_012458027.1|Porphyromonas gingivalis ATCC 33277|metallophosphoesterase
MKKIGLLSDTHGYIDEKYRIHFADCDEIWHAGDIGSVAVADYLSGLAPLRAVYGNIDGQDIRLQYPEVLRFCVEEVKVFMTHIGGYPGRYEPRIYRMLVQDPPRLFVCGHSHILKAMYDKKLDMLHLNPGAAGKYGFHAVRTLMRFVIDGQDIRDLQVIELADR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.86 | 6.1e-6 | ●○○○○ -0.3 | -0.30069183426290763 | 28900609 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)