Bacterial taxon 431947
Locus PGN_0412
Protein WP_012457491.1
nucleoside triphosphate pyrophosphohydrolase
Porphyromonas gingivalis ATCC 33277
Length 261 aa, Gene n/a, UniProt B2RHT6
>WP_012457491.1|Porphyromonas gingivalis ATCC 33277|nucleoside triphosphate pyrophosphohydrolase
MHTRAEKLEAFGRLLDVLDTLREQCPWDRKQTNESLRTNTIEEVYELSEALLGECPDDIRKELGDVLLHVAFYAKIGEEKGQFDIASVCHALCDKLIYRHPHIYGNVQVENAAEVVRNWEQLKLREKDGNKSVLSGVPKSLPALVKSYRMQEKAAGVGFDWEQREQVWPKVEEELNEVRGAIVSEDPDAMEAEFGDLLFAVVNAARLYGINPDNALERTNRKFDSRFSYVEQRAKQQGKALRDMTLSEMDALWNEAKQKGF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.6 | 1.1e-8 | ●○○○○ -0.8 | -0.8002098973710035 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)