Bacterial taxon 431947
Locus PGN_0301
Protein WP_004583835.1
OmpH family outer membrane protein
Porphyromonas gingivalis ATCC 33277
Length 163 aa, Gene n/a, UniProt B2RHH5
>WP_004583835.1|Porphyromonas gingivalis ATCC 33277|OmpH family outer membrane protein
MKKFFLMLLMALPLSLLAQKVAVVNTEEIISKMPEQVAATKQLNELAEKYRLDLKSMDDEFAKKTEEFVKEKDSLLENIRNRRQQELQDIQTRYQQSYQTMQEDLQKRQQQLFAPIQQKVADAIKKVGDEENCAYIMEAGMMLYTGATAIDLTAKVKAKLGIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.64 | 3.1e-10 | ●○○○○ -0.15 | -0.1526428751921223 | 28900609 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)