Bacterial taxon 431947
Locus PGN_0122
Protein WP_012457262.1
outer membrane lipoprotein Omp28
Porphyromonas gingivalis ATCC 33277
Length 291 aa, Gene n/a, UniProt B2RGZ6
>WP_012457262.1|Porphyromonas gingivalis ATCC 33277|outer membrane lipoprotein Omp28
MKKLFLSLTSLVMVFAVASCDIIDKDQTLLPAPTNVTPDNPDDNPSEIDITQTHTEKYVLAEEFTGQKCLYCPKGHRKLAALKEQYGKRLTVVGIHAGPASLVPPLFRTEAGDAYYSKFANNTSSLPALMVSRKKFGSSYVYDKSYKTWDVPIAEQMEQKAKMNIFAVAEYTDTQKIKVTVKGKVLEGNTLPKSMVQVYLLEDKLIAPQADGNTTVENYEHNHVLRGAVNGIWGEEFVDLKDYLYTYAVEPLSGMSFVAENYSIVAFVYDVQTFEVYDVVHVKINPQSDGK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -3,86 | <1e-323 | ○○○○○ 1,71 | 1.7078009771438232 | 28900609 |
Retrieved 1 of 1 entries in 1,1 ms
(Link to these results)