Bacterial taxon 431947
Locus PGN_0660
Protein WP_004585168.1
peroxiredoxin
Porphyromonas gingivalis ATCC 33277
Length 188 aa, Gene n/a, UniProt B2RII4
>WP_004585168.1|Porphyromonas gingivalis ATCC 33277|peroxiredoxin
MTPILNTVFPEFKLNAYHNGEFKVITNEDLKGKWSLVVFYPGDFTFVCPTELEDLANKYEEFKQLGVEVYSCSCDTHFVHKAWADASPAIKKVQYPMLADPSGALTRDLGILIDDVHMAYRGSFVINPEGIIKIVELNDNSVGRDAEEILRKIKAAQYVAAHDGQVCPAKWREGQQTLKPSIDLVGKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.62 | 3.7e-13 | ○○○○○ 0.53 | 0.5318254407230034 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)