Bacterial taxon 431947
Locus PGN_1744
Protein WP_021662358.1
PorT family protein
Porphyromonas gingivalis ATCC 33277
Length 204 aa, Gene n/a, UniProt B2RLL8
>WP_021662358.1|Porphyromonas gingivalis ATCC 33277|PorT family protein
MKKMILAATMLFATIGFANAQSRPALRLDANFVGSNLMQKVANTSVNNKMIVGLRVGAAAEFALSNDGFYLAPGLAYTMRGAKMESLSETTTRLHYLQIPVNAGMRFSFADNMAISLEAGPYFAYGVAGTIKTKVAGVTASVDAFGDNGYNRFDLGLGLSAALSYDRYYVQIGYEHGLLNMLKDAPDKTSLRNHDFFVGLGVRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.56 | 9.3e-8 | ●○○○○ -0.77 | -0.7708873193655954 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)