Bacterial taxon 431947
Locus PGN_1412
Protein WP_005874035.1
purine nucleoside phosphorylase I, inosine and guanosine-specific
Porphyromonas gingivalis ATCC 33277
Length 273 aa, Gene n/a, UniProt B2RKN6
>WP_005874035.1|Porphyromonas gingivalis ATCC 33277|purine nucleoside phosphorylase I, inosine and guanosine-specific
MKLQEQHYHEAASFLSSRLPGDAKTAIILGSGLGELAEKIENKTVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIICDHINNLPNPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQELNIPVKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFADDFVNDEQDVIRAANAASEKMGAIFARLIAAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.73 | <1e-323 | ○○○○○ 0.46 | 0.4562230433315757 | 28900609 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)