Bacterial taxon 431947
Locus PGN_0671
Protein WP_012457687.1
pyridoxine 5'-phosphate synthase
Porphyromonas gingivalis ATCC 33277
Length 238 aa, Gene pdxJ, UniProt B2RIJ5
>WP_012457687.1|Porphyromonas gingivalis ATCC 33277|pyridoxine 5'-phosphate synthase
MTRLSVNVNKIATLRNARGGNVPDVLRVALDCERFGAQGITVHPRPDERHIRRSDVYDLKKALTTEFNIEGNPDERFIRLIEEIRPEQVTMVPDAPDVLTSNAGWDVARNYDHLCRLVEQFHAWGIRTSIFIDTDLDNISWAAKTGTDRIELYTEPYAAAYHKDMAAAVQPYVKASAHAHSLGLGINAGHDLNLDNLRYFAERLPYLDEVSIGHALIADALYLGLEETIRQYRDQLAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.33 | 0.039 | ●○○○○ -0.62 | -0.6180197639292545 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)