Bacterial taxon 431947
Locus PGN_1940
Protein WP_012458625.1
pyrophosphatase
Porphyromonas gingivalis ATCC 33277
Length 116 aa, Gene n/a, UniProt B2RM64
>WP_012458625.1|Porphyromonas gingivalis ATCC 33277|pyrophosphatase
MSDITLREAQQSVDQWIKTLGIRYFNELTNMAILTEEVGEVARIIARRYGEQSEKESDKSKDLADEMADVLWVLLCLANQTGVDLTTAFHKNIEKKTVRDKERHQQNTKLHNNGSK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.21 | 1.6e-8 | ●●○○○ -1.21 | -1.211887556101592 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)