Bacterial taxon 431947
Locus PGN_0903
Protein WP_012457866.1
response regulator transcription factor
Porphyromonas gingivalis ATCC 33277
Length 227 aa, Gene fimR, UniProt B2RJ77
>WP_012457866.1|Porphyromonas gingivalis ATCC 33277|response regulator transcription factor
MISIVLVDDHELYRVGLRAAISQMQGLAEIVGECSSCEELETFLKEQKEPGLIILDIWLPDGNGVNIARKLKKLYPAVKIIILSSEVSEKTVNELLAIDVEGYICKTAQINDIGNAIRTVTTGSHFYGKSVSKMILDICVSRSADQSHKKSKKQQQQQNDSSELTQREKEVVQYLCDGYSAKETAEKMHLSYRTVETHRSNILHKLGFSNAAELIRYAVKSGLVDWQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.06 | <1e-323 | ●○○○○ -0.44 | -0.4398713211152538 | 28900609 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)