Bacterial taxon 431947
Locus PGN_0450
Protein WP_012457515.1
RNA polymerase sigma factor
Porphyromonas gingivalis ATCC 33277
Length 174 aa, Gene n/a, UniProt B2RHX4
>WP_012457515.1|Porphyromonas gingivalis ATCC 33277|RNA polymerase sigma factor
MEKQSDSYYISAVQAGDTESFAPLVERYSDMLYALLCRLLQDEEDAADLLQDTFVKAFRHIGRFDGRSSFSTWIYRIAYNEAIDHLRRRKAYVTDRVEELPDVPDEDLEPSGEDPELLQQALDSLPAADKALLLMFYSDDLSVRDIAEVTGMSESNVKVKLHRLRTKLYKMMRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.95 | <1e-323 | ●○○○○ -0.36 | -0.3637967593321689 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)