Bacterial taxon 431947
Locus PGN_0410
Protein WP_012457490.1
RNA pseudouridine synthase
Porphyromonas gingivalis ATCC 33277
Length 324 aa, Gene n/a, UniProt B2RHT4
>WP_012457490.1|Porphyromonas gingivalis ATCC 33277|RNA pseudouridine synthase
MQPPKSRSPRLRRQPDKVFEVREEDTLLPFLVRMLKDNSRTSVKQILTRRQVSINGVPTTRHDAELKAGDRVIVHRTQLPEELRHPLVRIIWQDDYFVLIEKKAGVSTVASGVNKDRTALRIVSDHLKQYDPEVKIFMLNRLDKDSAGMVLFAKNKEVQGFVVDKWSKVVLEQRFVMAIEGEMPDAEGTLDPPRYQTSIKGKQSRIVAETPSVHSVGTARYKVIRRGAVCSLVEVTLLSGRNNQLRRQMGQLGIPIAGDWRQGSSFRHLDCLALQGTRFVFRHPETGDTQEYKLPLPKLFRRLIHLEEGTAADQTISKTKKRSK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.36 | 3.0e-6 | ○○○○○ 0.03 | 0.03425480481047786 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)