Bacterial taxon 431947
Locus PGN_0277
Protein WP_012457387.1
RNA-binding S4 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 145 aa, Gene hslR, UniProt B2RHF1
>WP_012457387.1|Porphyromonas gingivalis ATCC 33277|RNA-binding S4 domain-containing protein
MEEVRIDRWMWATRIFKTRTIATDACKKSRVTVNGLQAKPSRMVRVGDVVQVRKPPVTYSFRILALAQNRMGAKLVKDFLENITPPEEYEILEMQRISGFVDRAKGTGRPTKKDRRELEQFSEEMPDLPYSFDSFDWDEEDFAEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.09 | 2.4e-10 | ○○○○○ 0.21 | 0.21362782213496964 | 28900609 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)