Bacterial taxon 431947
Locus PGN_1462
Protein WP_012458288.1
rRNA maturation RNase YbeY
Porphyromonas gingivalis ATCC 33277
Length 151 aa, Gene ybeY, UniProt B2RKT6
>WP_012458288.1|Porphyromonas gingivalis ATCC 33277|rRNA maturation RNase YbeY
MAKINFYAEGVSLPRIRRRIVGKWIAEVCSRYGKAVGEISYLFCDDEYILKANQEFLDHDYYTDIITFDSCEADTVNGDLLISLDTVRSNARALDLRYEDELHRVIIHGILHLCGLKDKSKKDEAQMRAAEEEALVMLQETIGSELSLLHT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.94 | 0.022 | ●○○○○ -0.35 | -0.3545107548167996 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)