Bacterial taxon 431947
Locus PGN_0230
Protein WP_012457349.1
serine O-acetyltransferase
Porphyromonas gingivalis ATCC 33277
Length 144 aa, Gene n/a, UniProt B2RHA4
>WP_012457349.1|Porphyromonas gingivalis ATCC 33277|serine O-acetyltransferase
MLNAIYFYRLSHWLYRHHIPILPKLITLLIFLIYNSKIPPQAKIGKGSKFGYGGISVVVHHDSVIGENCSIGQLVTIGGGNSKYPGVPTIGNNVRISCGSIVGGITIGNNVVIGAHTVVNFPVPDNAVVVGNPGRIVRIKESKC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.99 | <1e-323 | ●●○○○ -1.06 | -1.0600164404099515 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)