Bacterial taxon 431947
Locus PGN_0274
Protein WP_004583806.1
sigma-70 family RNA polymerase sigma factor
Porphyromonas gingivalis ATCC 33277
Length 193 aa, Gene n/a, UniProt B2RHE8
>WP_004583806.1|Porphyromonas gingivalis ATCC 33277|sigma-70 family RNA polymerase sigma factor
MSSFHKLTDDELVSLYTEGCDEAFDVILSRYDAVVHTYIRFSVSDADLAEDIFQDTFIKVIHTLRRGQYIPTGKFKAWLLRLAHNLVMDHYRRVRGEGARLQSFDDDDAAPVEKVADSNLTAEEQLIELATIEELEQYLSVLPEVQQEVVRMRYWEDMSFREIADATGVSINTALGRMRYALINLRKMMGMSA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.55 | 0.024 | ○○○○○ 0.58 | 0.5758707036639293 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)