Bacterial taxon 431947
Locus PGN_0160
Protein WP_039416892.1
sulfur carrier protein ThiS
Porphyromonas gingivalis ATCC 33277
Length 66 aa, Gene thiC, UniProt B2RH34
>WP_039416892.1|Porphyromonas gingivalis ATCC 33277|sulfur carrier protein ThiS
MQVTINNQPIICLEGMGLATLLEAERIQVERTAIAVNGEVVPRASWGDFRLSEGDEILIIQATYGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.24 | 0.00087 | ○○○○○ 0.11 | 0.11385130285567399 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)