Bacterial taxon 431947
Locus PGN_1817
Protein WP_012458555.1
T9SS type A sorting domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 145 aa, Gene n/a, UniProt B2RLU1
>WP_012458555.1|Porphyromonas gingivalis ATCC 33277|T9SS type A sorting domain-containing protein
MKHLLLTLLLSLPGCLGAKAQQTLSFVYDASGNRVARVIIMSSIIATGEEPSEEERDEPKEFNEILGDTQIRLYPNPVESILTISIGSLEDKGKYAIFNMHGSLVLQGSLNHGDTKVDMSRLPAGNYAMRLFIGKEQSTWKIIKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.31 | 4.8e-5 | ●○○○○ -0.61 | -0.6077720307285965 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)