Bacterial taxon 431947
Locus PGN_0080
Protein WP_012457224.1
tetracycline resistance element mobilization regulatory protein RteC
Porphyromonas gingivalis ATCC 33277
Length 108 aa, Gene n/a, UniProt B2RGV4
>WP_012457224.1|Porphyromonas gingivalis ATCC 33277|tetracycline resistance element mobilization regulatory protein RteC
MRMQGLLSTLPVKPTEKLRWTGKATDLVELLYALDTCDCINDGEIGIEELADAFSEIFGIEIKNCYNVYMNMKRRKDDSRTYFLDELREELNKRMVESDLKGGKFKKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.16 | <1e-323 | ●●○○○ -1.18 | -1.1750533419073923 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)