Bacterial taxon 431947
Locus PGN_0388
Protein WP_018964814.1
thiol peroxidase
Porphyromonas gingivalis ATCC 33277
Length 167 aa, Gene tpx, UniProt B2RHR2
>WP_018964814.1|Porphyromonas gingivalis ATCC 33277|thiol peroxidase
MATVTLQGKININTNGQLPGVGSVAPDFKAVKADLSEVSLSEFKGKRVVINIFPSIDTGVCAASVRRFNQEASSLDNTVVLCLSKDLPFAQARFCGAEGLDKVITVSAFRCDCFEKGYGLLMTDGPLKGLLARAVVVVDENGKIIYEELVPEITQEPNYEAAIAALK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.62 | <1e-323 | ●○○○○ -0.82 | -0.8151927462830317 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)