Bacterial taxon 431947
Locus PGN_0779
Protein WP_004585294.1
uracil phosphoribosyltransferase
Porphyromonas gingivalis ATCC 33277
Length 216 aa, Gene upp, UniProt B2RIV3
>WP_004585294.1|Porphyromonas gingivalis ATCC 33277|uracil phosphoribosyltransferase
MEVIHLGAEHSLLNRFVMEMRDVTIQNDRLRFRRNIERVGEVMAYEISKKMTQQVRTVTTPLGEAECSVPQDKVVLATILRAGLPFHHGFLNYFDYCENAFVSAYRKYKDRLNFDIHIEYIASPDITDKVLIISDPMLATGSSMELAYKALLTKGNPKHIHIASIIASQQAVDYIRGVMPDNTTIWIAAIDPTIDEHSYIVPGLGDAGDLAYGEKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.91 | <1e-323 | ●●○○○ -1.01 | -1.006162699306301 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)