Bacterial taxon 431947
Locus PGN_1722
Protein WP_005873721.1
uridine kinase
Porphyromonas gingivalis ATCC 33277
Length 207 aa, Gene udk, UniProt B2RLJ6
>WP_005873721.1|Porphyromonas gingivalis ATCC 33277|uridine kinase
MNTTIIGVAGGSASGKSTLVKKLCEAFVEEDVLVLCHDYYYKANDHLSLEERKKLNYDHPNAFDTDMFVRDILSLKAGKTIERPVYSFVEHNRLQEKVTVRPAKVIVLDGILIFENKELRDLMNVKVFVDTDADIRLARRLVRDVQERGRNMDSVLAQYFSTVRPMHEDFVEPSKRYADLIIPEGGFNSVALSLLVEKIRSVIRKEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.6 | <1e-323 | ●○○○○ -0.8 | -0.8026643647188765 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)