Bacterial taxon 216597
Locus SL1344_0187
Protein CBW16289.1
dosage-dependent dnaK suppressor protein
Salmonella enterica Serovar Typhimurium SL1344
Length 151 aa, Gene dksA, UniProt A0A0H3N847
>CBW16289.1|Salmonella enterica Serovar Typhimurium SL1344|dosage-dependent dnaK suppressor protein
MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILEAWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus gp91 phox) | liver | BTO:0000759 | 48 h | 216,517 | -4.85 | 1.4e-12 | ●●●●○ -3.58 | -3.582133393917825 | 26787719 |
| Mouse (Mus musculus gp91 phox) | spleen | BTO:0001281 | 48 h | 216,517 | -3.47 | 1.5e-5 | ●●●○○ -2.56 | -2.5556770353803935 | 26787719 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)