Bacterial taxon 909946
Locus STM474_0154
Protein WP_000936329.1
1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD
Salmonella enterica Serovar Typhimurium ST4 74
Length 187 aa, Gene ampD, UniProt E8XH57
>WP_000936329.1|Salmonella enterica Serovar Typhimurium ST4 74|1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD
MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGGPWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQGRERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIASYPAIADNMTGHCNIAPDRKTDPGPAFDWPRFRALVALSSHKEMT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 169,731 | 0.98 | 0.73 | ○○○○○ 0.69 | 0.68693806111875 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 169,731 | 1.38 | 0.076 | ○○○○○ 0.9 | 0.896315877233213 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)