Bacterial taxon 909946
Locus STM474_3739
Protein WP_000743277.1
16S rRNA (guanine(966)-N(2))-methyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 198 aa, Gene rsmD, UniProt E8XF84
>WP_000743277.1|Salmonella enterica Serovar Typhimurium ST4 74|16S rRNA (guanine(966)-N(2))-methyltransferase
MKKPTHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVMVDAHCLDCFAGSGALGLEALSRYAAQATLLEMDRAVSQQLQKNLATLKANNARVVNTNTLTFLSQPGTPHHVVFVDPPFRKGLLEETLQLLETQGWLADDALIYVESEVENGLPPVPANWALYREKVAGQVAYRLYQRDAQGENDVD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,762,001 | 2.19 | 0.0093 | ○○○○○ 1.31 | 1.31194081234903 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,762,001 | -0.71 | 0.78 | ●○○○○ -0.19 | -0.191673273887012 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,762,001 | 0.78 | 0.65 | ○○○○○ 0.58 | 0.579762815683866 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)