Bacterial taxon 909946
Locus STM474_0797
Protein WP_000301556.1
2,3-diphosphoglycerate-dependent phosphoglycerate mutase
Salmonella enterica Serovar Typhimurium ST4 74
Length 250 aa, Gene gpmA, UniProt E8XB02
>WP_000301556.1|Salmonella enterica Serovar Typhimurium ST4 74|2,3-diphosphoglycerate-dependent phosphoglycerate mutase
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVIIAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKAAAVANQGKAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 836,197 | -1.44 | 0.0045 | ●○○○○ -0.57 | -0.572989275762483 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 836,197 | -1.04 | 0.35 | ●○○○○ -0.37 | -0.365274911429469 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 836,197 | -0.81 | 0.89 | ●○○○○ -0.24 | -0.24179176442367 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)