Bacterial taxon 909946
Locus STM474_0266
Protein WP_000154871.1
2,5-didehydrogluconate reductase DkgB
Salmonella enterica Serovar Typhimurium ST4 74
Length 267 aa, Gene dkgB, UniProt E8XIS0
>WP_000154871.1|Salmonella enterica Serovar Typhimurium ST4 74|2,5-didehydrogluconate reductase DkgB
MTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQIYDNEAAVGQAIAESGVPRNELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGDAVSVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAAVGADNIATNQIELSPYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPAWD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 295,713 | 1.69 | 0.024 | ○○○○○ 1.06 | 1.05634430324108 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 295,581 | -0.38 | 0.5 | ●○○○○ -0.02 | -0.0224188822036441 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 295,713 | 0.75 | 0.58 | ○○○○○ 0.57 | 0.568318986657618 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 295,581 | 0.85 | 0.8 | ○○○○○ 0.62 | 0.61764799262273 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 295,713 | 1.26 | 0.7 | ○○○○○ 0.83 | 0.829205133742388 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 295,581 | 1.74 | 0.35 | ○○○○○ 1.08 | 1.08301055649299 | 23637626 |
Retrieved 6 of 6 entries in 1.1 ms
(Link to these results)