Bacterial taxon 909946
Locus STM474_0192
Protein WP_000150773.1
2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
Salmonella enterica Serovar Typhimurium ST4 74
Length 159 aa, Gene folK, UniProt E8XHY1
>WP_000150773.1|Salmonella enterica Serovar Typhimurium ST4 74|2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMKNRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 213,449 | -9.02 | 1.0e-9 | ●●●●● -4.51 | -4.50663780954099 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 213,449 | -6.79 | 4.9e-23 | ●●●●○ -3.35 | -3.35044881224861 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 213,449 | -4.82 | 3.4e-14 | ●●●○○ -2.32 | -2.32444097471495 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)