Bacterial taxon 909946
Locus STM474_3406
Protein WP_001057715.1
2-dehydro-3-deoxyglucarate aldolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 256 aa, Gene garL, UniProt E8XC66
>WP_001057715.1|Salmonella enterica Serovar Typhimurium ST4 74|2-dehydro-3-deoxyglucarate aldolase
MNNAIFPNKFKAALAAQQVQIGCWSALASPITTEVLGLAGFDWLVLDGEHAPNDVTTLIPQLMALKGSASAPVVRVPTNEPVIIKRMLDIGFYNFLIPFVETQEEAARAVASTRYPPEGIRGVSVSHRANMFGTVPDYFAQSNKNITIIVQIESQLGVDNVDAIAATEGVDGIFVGPSDLAAALGHLGNASHPDVQQTIQHIFARAKAHGKPCGILAPVEADARRYLEWGATFVAVGSDLGAFRASTQKLADTFKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,438,784 | -1.82 | 0.0015 | ●○○○○ -0.77 | -0.766950493279997 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,438,771 | -1.15 | 0.094 | ●○○○○ -0.42 | -0.418705496231085 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,438,784 | -1.1 | 0.31 | ●○○○○ -0.4 | -0.396442919653257 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,438,451 | -1.1 | 0.068 | ●○○○○ -0.39 | -0.393559737803834 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,438,784 | -0.28 | 0.94 | ○○○○○ 0.03 | 0.031955264212454 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,438,451 | -0.06 | 0.98 | ○○○○○ 0.14 | 0.144069832972542 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,438,771 | 0.29 | 0.83 | ○○○○○ 0.33 | 0.325725197453891 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,438,771 | 0.94 | 0.95 | ○○○○○ 0.67 | 0.666987639346503 | 23637626 |
Retrieved 8 of 8 entries in 0.9 ms
(Link to these results)