Bacterial taxon 909946
Locus STM474_3764
Protein WP_000954235.1
23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ
Salmonella enterica Serovar Typhimurium ST4 74
Length 280 aa, Gene yhiR, UniProt E8XFA9
>WP_000954235.1|Salmonella enterica Serovar Typhimurium ST4 74|23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAGAGRYQLGSEHAERTGEYLEGIARIWQQDDLPAELEPYISVVKHFNRSGQLRYYPGSPLIARQLLREQDSLQLTELHPSDFPLLRAEFQKDNRARVERADGYQQLKAKLPPVSRRGLILIDPPYEMKTDYQAVVSGISEGYKRFATGTYALWYPVVLRQQIKRMIHELEATGIRKILQIELAIRPDSDQRGMTASGMIVVNPPWKLEQQMNNVLPWLHSRLAPNGHGHTSVSWIVPE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,789,136 | -0.47 | 0.72 | ●○○○○ -0.07 | -0.0663167670503353 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,789,125 | -0.03 | 0.99 | ○○○○○ 0.16 | 0.162632307732616 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,789,136 | 0.03 | 0.97 | ○○○○○ 0.19 | 0.19358499145442 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,789,136 | 0.87 | 0.79 | ○○○○○ 0.63 | 0.627622735346631 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,789,036 | 1.44 | 0.092 | ○○○○○ 0.92 | 0.924320253923515 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,789,036 | 1.64 | 0.34 | ○○○○○ 1.03 | 1.0299723825137 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,789,036 | 2.15 | 0.17 | ○○○○○ 1.29 | 1.29196709775354 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,789,125 | 2.23 | 0.085 | ○○○○○ 1.34 | 1.33591496871952 | 23637626 |
Retrieved 8 of 8 entries in 1.7 ms
(Link to these results)