Bacterial taxon 909946
Locus STM474_4601
Protein WP_000893398.1
3'(2'),5'-bisphosphate nucleotidase CysQ
Salmonella enterica Serovar Typhimurium ST4 74
Length 246 aa, Gene cysQ, UniProt E8XAS9
>WP_000893398.1|Salmonella enterica Serovar Typhimurium ST4 74|3'(2'),5'-bisphosphate nucleotidase CysQ
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIPVLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVLKVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPGFRVTIY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,662,431 | 0.52 | 0.91 | ○○○○○ 0.45 | 0.446263143968859 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,662,431 | 0.71 | 0.27 | ○○○○○ 0.55 | 0.546257141838074 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,662,431 | 1.15 | 0.28 | ○○○○○ 0.78 | 0.776482310512397 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)