Bacterial taxon 909946
Locus STM474_4583
Protein WP_000056761.1
3-keto-L-gulonate-6-phosphate decarboxylase UlaD
Salmonella enterica Serovar Typhimurium ST4 74
Length 216 aa, Gene ulad, UniProt E8XAR1
>WP_000056761.1|Salmonella enterica Serovar Typhimurium ST4 74|3-keto-L-gulonate-6-phosphate decarboxylase UlaD
MSLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIQQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAESPVEAARQFKRSIAQLWG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,648,127 | 0.46 | 0.93 | ○○○○○ 0.42 | 0.415023706082262 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,648,127 | 0.68 | 0.41 | ○○○○○ 0.53 | 0.53257587856645 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,648,127 | 0.88 | 0.53 | ○○○○○ 0.64 | 0.635755834347697 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)