Bacterial taxon 909946
Locus STM474_3750
Protein WP_000285376.1
4'-phosphopantetheinyl transferase AcpT
Salmonella enterica Serovar Typhimurium ST4 74
Length 192 aa, Gene acpT, UniProt E8XF95
>WP_000285376.1|Salmonella enterica Serovar Typhimurium ST4 74|4'-phosphopantetheinyl transferase AcpT
MYQVVLGKVSTLSAGQLPDALIAQAPQGVRRASWLAGRVLLSRALSPLPEMVYGEQGKPAFSAGAPLWFNLSHSGDTIALLLSDEGEVGCDIEVIRPRDNWRSLANAVFSLGEHAEMEAERPEQQLAAFWRIWTRKEAIVKQRGGSAWQIVSVDSTLPSALSVSQCQLDTLSLAVCTPTPFTLTPQTITKAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,772,524 | 0.62 | 0.7 | ○○○○○ 0.5 | 0.501150999624256 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,772,524 | 1.22 | 0.8 | ○○○○○ 0.81 | 0.813087404703506 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)