Bacterial taxon 909946
Locus STM474_3343
Protein WP_000245238.1
4,5-DOPA dioxygenase extradiol
Salmonella enterica Serovar Typhimurium ST4 74
Length 276 aa, Gene ygiD, UniProt E8XBB8
>WP_000245238.1|Salmonella enterica Serovar Typhimurium ST4 74|4,5-DOPA dioxygenase extradiol
MVMLTKCLSSKDNIMSLTCMPALFLGHGSPMNVLDDNDYTRAWRRLGEALPRPQAIVVVSAHWYTRGTGVTAMERPQTLHDFGGFPQALYDTHYPAPGSPALAQRLVELLAPVPVALDKEAWGFDHGSWGVLIKMYPNADIPMVQLSVDSTKPAAWHFEVGRKLATLRDEGVMLVASGNVVHNLRTVRWHGDNIPYPWAASFNDFVKANLTWQGPVEQHPLVNYLQHEGGALSNPTPEHFLPLLYVLGAWDGKEPITIPVDGIEMGSISMLSVQVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,372,866 | 1.81 | 0.027 | ○○○○○ 1.12 | 1.11746792182525 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,373,101 | -0.33 | 0.92 | ○○○○○ 0.01 | 0.00778602726648871 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,372,866 | 0.37 | 0.8 | ○○○○○ 0.37 | 0.369223360565593 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,373,101 | 0.38 | 0.5 | ○○○○○ 0.37 | 0.372303930825117 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,373,101 | 0.49 | 0.71 | ○○○○○ 0.43 | 0.429973495271807 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,372,866 | 1.23 | 0.61 | ○○○○○ 0.81 | 0.814346959459598 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)