Bacterial taxon 909946
Locus STM474_1090
Protein WP_001195556.1
4-hydroxyphenylacetate 3-monooxygenase reductase subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 170 aa, Gene hpaC, UniProt E8XE54
>WP_001195556.1|Salmonella enterica Serovar Typhimurium ST4 74|4-hydroxyphenylacetate 3-monooxygenase reductase subunit
MQVDEQRLRFRDAMASLAAAVNIVTTAGHAGRCGITATAVCSVTDTPPSVMVCINANSAMNPVFQGNGRLCINVLNHEQELMARHFAGMTGMAMEERFHQPCWQNGPLGQPVLNGALAGLEGEISEVQTIGTHLVYLVAIKNIILSQDGHGLIYFKRRFHPVRLEMEAPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,141,631 | 0.42 | 0.93 | ○○○○○ 0.4 | 0.396993378311392 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,141,631 | 0.85 | 0.24 | ○○○○○ 0.62 | 0.619998259416473 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,141,631 | 0.99 | 0.52 | ○○○○○ 0.69 | 0.693035313463387 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)