Bacterial taxon 909946
Locus STM474_0632
Protein WP_001250381.1
4Fe-4S dicluster domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 185 aa, Gene n/a, UniProt E8X983
>WP_001250381.1|Salmonella enterica Serovar Typhimurium ST4 74|4Fe-4S dicluster domain-containing protein
MRRAFLVNSDKCIGCRGCAMACKSFNQLEPDRFWRYVYPLDKDIYPHEERAFYSLACNHCEHPACVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYGAPRFNEETRKAEKCSMCYERLDIGMNPACVNACPVGALSIIDLDADPVPDNAVQYPPGFPHMPQLNPGTRFILARQPKQPEDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 675,721 | 0.03 | 1 | ○○○○○ 0.19 | 0.193625166160661 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 675,721 | 0.14 | 0.93 | ○○○○○ 0.25 | 0.249759723013456 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 675,721 | 0.96 | 0.2 | ○○○○○ 0.68 | 0.67796925593927 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)