Bacterial taxon 909946
Locus STM474_4127
Protein WP_001213560.1
5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB
Salmonella enterica Serovar Typhimurium ST4 74
Length 238 aa, Gene yigB, UniProt E8XJD8
>WP_001213560.1|Salmonella enterica Serovar Typhimurium ST4 74|5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB
MRFYRPLGRIAALTFDLDDTLYDNRPVILRTEQEALAFMQNYHPSLRSFQNVDLQRIRQAVREAEPEIYHDVTRWRHRAIEQAMRDAGLSAQEAIAGANAAMMHFAKWRSQIEVPQATHETLQQLAKKWPLVAITNGNAQPELFGLGDYFKFVLRAGPDGRSKPFSDMYFLAAEKLHVPIGEILHVGDDLTTDVAGAIRCGMQACWIKPENADLMRTQDSRLLPHIEISRLASLTSLI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,176,423 | 0.38 | 0.94 | ○○○○○ 0.38 | 0.375529434033945 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,176,423 | 0.44 | 0.56 | ○○○○○ 0.41 | 0.40695039059204 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,176,423 | 0.84 | 0.64 | ○○○○○ 0.62 | 0.615028842322421 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)