Bacterial taxon 909946
Locus STM474_0734
Protein WP_001188373.1
5-oxoprolinase subunit PxpB
Salmonella enterica Serovar Typhimurium ST4 74
Length 218 aa, Gene ybgJ, UniProt E8XAU6
>WP_001188373.1|Salmonella enterica Serovar Typhimurium ST4 74|5-oxoprolinase subunit PxpB
MQRARCYLLGETAVVLELEPPITLASQKRIWRLTQRLVDMPNVVEAIPGMNNITVILREPQTLALDAIERLQRWWEESEALEPDSRSVEIPVIYGGAGGPDLAAVARHSGLSEKQVVELHASVEYVVWFLGFQPGFPYLGNLPEPLHMPRRAEPRLQVPAGSVGIGGAQTGIYPLSTPGGWQLIGLTPLKLFDPMRETPVLLRPGDSVRFVPQKEGIC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 778,538 | 0.86 | 0.79 | ○○○○○ 0.62 | 0.622971947955033 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 778,538 | 1.23 | 0.43 | ○○○○○ 0.82 | 0.81788147673948 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 778,417 | 1.41 | 0.5 | ○○○○○ 0.91 | 0.911863419998789 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 778,417 | 2.7 | 0.33 | ○○○○○ 1.58 | 1.58166098842132 | 23637626 |
Retrieved 4 of 4 entries in 0.4 ms
(Link to these results)