Bacterial taxon 909946
Locus STM474_3545
Protein WP_001145849.1
50S ribosomal protein L11 methyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 293 aa, Gene prmA, UniProt E8XD88
>WP_001145849.1|Salmonella enterica Serovar Typhimurium ST4 74|50S ribosomal protein L11 methyltransferase
MPWIQLKLNTTGANAEELSDALMEAGAVSITFQDTHDTPVFEPLPGETRLWGDTDVIGLFDAETDMKDVVAILEQHPLLGAGFAHKIEQLEDKDWEREWMDNFHPMRFGERLWICPSWRDIPDENAVNVMLDPGLAFGTGTHPTTSLCLQWLDGLDLNGKTVIDFGCGSGILAIAALKLGAAKAIGIDIDPQAIQASRDNAERNGVSDRLELYLPKDQPEAMKADVVVANILAGPLRELAPLISVLPVEGGLLGLSGILASQAESVCDAYAELFTLDPVVEKEEWCRITGRKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,575,177 | -0.16 | 0.96 | ○○○○○ 0.1 | 0.095230718915616 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,575,177 | 0.32 | 0.86 | ○○○○○ 0.34 | 0.342064863429117 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,575,177 | 0.9 | 0.11 | ○○○○○ 0.64 | 0.643426407768504 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)