Bacterial taxon 909946
Locus STM474_4031
Protein WP_000078081.1
6-phosphogluconate phosphatase
Salmonella enterica Serovar Typhimurium ST4 74
Length 221 aa, Gene yieH, UniProt E8XHU0
>WP_000078081.1|Salmonella enterica Serovar Typhimurium ST4 74|6-phosphogluconate phosphatase
MSQIEAVFFDCDGTLVDSEVICSRAYVTMFRQFGITLELTEVFRRFKGVKLYEIIDTISKEHGVALAKAELEPVYRAEVARLFDTELEAIAGANTLLESIKTPMCVVSNGPVSKMQHSLGKLGMLHHFPDLLFSGYDIQRWKPDPALMLHAANAMKVNVEKCILVDDSSAGAQSGIAAGMEVFYFCADPHNKPIDHPNVTTFTDLAQLPGLWKARGWEITR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,080,698 | -1.66 | 0.0023 | ●○○○○ -0.69 | -0.685739975975903 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,080,718 | -0.94 | 0.21 | ●○○○○ -0.31 | -0.311049406389108 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,080,772 | -0.4 | 0.59 | ●○○○○ -0.03 | -0.0310064475397914 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,080,753 | -0.36 | 0.6 | ●○○○○ -0.01 | -0.0100195229165058 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,080,698 | 0.04 | 1 | ○○○○○ 0.2 | 0.196044602559542 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,080,772 | 0.05 | 1 | ○○○○○ 0.2 | 0.201062475352399 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,080,718 | 0.18 | 0.99 | ○○○○○ 0.27 | 0.271935002267131 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,080,753 | 0.34 | 0.95 | ○○○○○ 0.35 | 0.352367338923242 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,081,037 | 0.8 | 0.82 | ○○○○○ 0.59 | 0.591609610604174 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,081,037 | 1.02 | 0.47 | ○○○○○ 0.71 | 0.708398106381261 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,081,037 | 1.1 | 0.19 | ○○○○○ 0.75 | 0.750341595450531 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,080,718 | 1.21 | 0.44 | ○○○○○ 0.81 | 0.80765547241549 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,080,698 | 1.35 | 0.56 | ○○○○○ 0.88 | 0.877808945259959 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,080,772 | 1.4 | 0.49 | ○○○○○ 0.91 | 0.905729397055917 | 23637626 |
Retrieved 14 of 14 entries in 1.2 ms
(Link to these results)