Bacterial taxon 909946
Locus STM474_3095
Protein WP_001199961.1
7-carboxy-7-deazaguanine synthase QueE
Salmonella enterica Serovar Typhimurium ST4 74
Length 223 aa, Gene queE, UniProt E8X8N4
>WP_001199961.1|Salmonella enterica Serovar Typhimurium ST4 74|7-carboxy-7-deazaguanine synthase QueE
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWDKLSDREVSLFSILAKTKESDKWGAASSEDLLAVINRQGYTARHVVITGGEPCIHDLMPLTDLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRVRDIEALDELLATLSDDKPRVIALQPISQKEDATRLCIETCIARNWRLSMQTHKYLNIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,118,688 | 0.41 | 0.75 | ○○○○○ 0.39 | 0.391494990356977 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,118,688 | 1.39 | 0.093 | ○○○○○ 0.9 | 0.899394851638594 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,118,688 | 1.84 | 0.49 | ○○○○○ 1.13 | 1.13031285781805 | 23637626 |
Retrieved 3 of 3 entries in 0.5 ms
(Link to these results)