Bacterial taxon 909946
Locus STM474_4306
Protein WP_001068659.1
acetylglutamate kinase
Salmonella enterica Serovar Typhimurium ST4 74
Length 257 aa, Gene argB, UniProt E8XL78
>WP_001068659.1|Salmonella enterica Serovar Typhimurium ST4 74|acetylglutamate kinase
MNPLIIKLGGVLLDSEEALERLFTALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVKKKDGLRVTPADQIGIITGALAGTANKTLLAWAKKHHIASVGLFLGDGDSVNVTQLDEALGHVGLAQPGSPKLINMLLENGFLPVVSSIGVTDDGQLMNVNADQAATALAATLGADLILLSDVSGILDGKGQRIAEMTASKAEQLIDQGIITDGMIVKVNAALDAARALGRPVDIASWRHAEQLPALFNGTPIGTRILA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,362,373 | -2.14 | 0.068 | ●○○○○ -0.93 | -0.933963486788713 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,362,283 | -0.64 | 0.25 | ●○○○○ -0.16 | -0.157067191878386 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,362,373 | -0.01 | 1 | ○○○○○ 0.17 | 0.169823388522555 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,362,611 | -0.01 | 0.99 | ○○○○○ 0.17 | 0.172059618477089 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,362,373 | 0.07 | 0.82 | ○○○○○ 0.22 | 0.215142511571013 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,362,283 | 0.2 | 1 | ○○○○○ 0.28 | 0.282799497810553 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,362,611 | 0.32 | 0.99 | ○○○○○ 0.34 | 0.342042290376078 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,362,273 | 0.52 | 0.71 | ○○○○○ 0.45 | 0.449590762628129 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,362,611 | 0.78 | 0.59 | ○○○○○ 0.58 | 0.584720862382071 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,362,273 | 0.83 | 0.89 | ○○○○○ 0.61 | 0.607864554536956 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,362,273 | 1.3 | 0.13 | ○○○○○ 0.85 | 0.851776121986192 | 23637626 |
Retrieved 11 of 11 entries in 1.9 ms
(Link to these results)