Bacterial taxon 909946
Locus STM474_1753
Protein WP_000210317.1
acyl-CoA thioester hydrolase YciA
Salmonella enterica Serovar Typhimurium ST4 74
Length 133 aa, Gene yciA, UniProt E8XKV3
>WP_000210317.1|Salmonella enterica Serovar Typhimurium ST4 74|acyl-CoA thioester hydrolase YciA
MTTMDNTPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCVKRGTTSISINIEVWVKKVASEPIGQRYKATEALFIYVAVDPDGKPRPLPVQG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,787,878 | -0.89 | 0.57 | ●○○○○ -0.28 | -0.28316711228101 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,787,878 | -0.03 | 1 | ○○○○○ 0.16 | 0.163191752500204 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,787,878 | 1.04 | 0.095 | ○○○○○ 0.72 | 0.719283468509544 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)