Bacterial taxon 909946
Locus STM474_3830
Protein WP_001182588.1
acyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 331 aa, Gene yiaH, UniProt E8XFX2
>WP_001182588.1|Salmonella enterica Serovar Typhimurium ST4 74|acyltransferase
MQPKINWIDNLRGIACLMVVMIHTTTWYITNAHSVSPLNWDIANVLNSASRVSVPLFFMISGYLFFGERCAQPRHFLRIALCLIFYSVVALAYISLFTSINVELSLKNVLQKPVFYHLWFFFAITVIYLVSPLIQVKNVSGKMLLMLMVIIGIIANPNTVPQKIGGVEWLPINLYISGDTFYYILYGILGRAIGMMETQKSSLTLICTALFIIAVFVISRGTLHELRWRGNFADTWYLYCGPMVFICAVSLFTVVKNKLNARTLPGLGLISRHSLGIYGFHALIIHALRTNGLELKRWPPLDIVWVFAATVTGSLLLSMLLQRIDKRKWVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,069 | -7.48 | 1.1e-27 | ●●●●○ -3.71 | -3.70637145578485 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,472 | -4.31 | 9.0e-9 | ●●●○○ -2.06 | -2.05920253870582 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,069 | -3.76 | 0.00047 | ●●○○○ -1.78 | -1.77625683801806 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,472 | -3.25 | 0.00027 | ●●○○○ -1.51 | -1.50869581988304 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,069 | -3.02 | 0.0049 | ●●○○○ -1.39 | -1.39282797511282 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,477 | -1.89 | 0.0002 | ●○○○○ -0.8 | -0.80213916487476 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,553 | -1.31 | 0.017 | ●○○○○ -0.5 | -0.502225310551842 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,472 | -2.01 | 0.095 | ●○○○○ -0.87 | -0.865062432796734 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,553 | -1.56 | 0.19 | ●○○○○ -0.64 | -0.635100195243628 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,314 | -0.85 | 0.28 | ●○○○○ -0.26 | -0.263441641028441 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,553 | -0.61 | 0.82 | ●○○○○ -0.14 | -0.139632549772322 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,477 | -0.59 | 0.7 | ●○○○○ -0.13 | -0.129493410702634 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,864,795 | -0.47 | 0.88 | ●○○○○ -0.07 | -0.0651213897269543 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,314 | -0.19 | 0.92 | ○○○○○ 0.08 | 0.0799309578221748 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,864,795 | 0.11 | 0.89 | ○○○○○ 0.24 | 0.236624185772398 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,477 | 0.43 | 0.94 | ○○○○○ 0.4 | 0.398640476872231 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,314 | 0.53 | 0.9 | ○○○○○ 0.45 | 0.45414715158606 | 23637626 |
Retrieved 17 of 17 entries in 1.1 ms
(Link to these results)