Bacterial taxon 909946
Locus STM474_1830
Protein WP_001083582.1
addiction module toxin, GnsA/GnsB family
Salmonella enterica Serovar Typhimurium ST4 74
Length 57 aa, Gene n/a, UniProt E8X8H9
>WP_001083582.1|Salmonella enterica Serovar Typhimurium ST4 74|addiction module toxin, GnsA/GnsB family
MNSEELTHKAEEEIAALISKKVAELRKKTGQEVSEIEFAPRETMKGLEGYHVKIKLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,866,554 | -0.11 | 0.87 | ○○○○○ 0.12 | 0.118439091199862 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,866,554 | -0.1 | 0.95 | ○○○○○ 0.13 | 0.127206066270421 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,866,554 | 0.17 | 0.99 | ○○○○○ 0.26 | 0.263706175906024 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)