Bacterial taxon 909946
Locus STM474_3073
Protein WP_001173663.1
adenylyl-sulfate kinase
Salmonella enterica Serovar Typhimurium ST4 74
Length 201 aa, Gene cysC, UniProt E8X8L2
>WP_001173663.1|Salmonella enterica Serovar Typhimurium ST4 74|adenylyl-sulfate kinase
MALHDENVVWHSHPVTVAAREQLHGHRGVVLWFTGLSGSGKSTVAGALEEALHQRGVSTYLLDGDNVRHGLCRDLGFSDADRQENIRRVGEVASLMADAGLIVLTAFISPHRAERQLVKERVGHDRFIEIYVNTPLAICEQRDPKGLYKKARAGELRNFTGIDAIYEAPDSPQVHLNGEQLVTNLVSQLLDLLRRRDIIRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,095,323 | 1.75 | 0.014 | ○○○○○ 1.09 | 1.08672207388697 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,095,323 | -1.01 | 0.45 | ●○○○○ -0.35 | -0.349593417663024 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,095,323 | 1.43 | 0.49 | ○○○○○ 0.92 | 0.919714194070329 | 23637626 |
Retrieved 3 of 3 entries in 0.5 ms
(Link to these results)