Bacterial taxon 909946
Locus STM474_1034
Protein WP_000725267.1
Ail/OmpX
Salmonella enterica Serovar Typhimurium ST4 74
Length 165 aa, Gene n/a, UniProt E8XDJ7
>WP_000725267.1|Salmonella enterica Serovar Typhimurium ST4 74|Ail/OmpX
MKKIVVAVLVGLALGSIGVANAAGYKNTVSIGYAYTDLSGWLSGNANGANIKYNWEDLDSGFGAMGSVTYTSADVNNYGYKVGDADYTSLLVGPSYRFNDYLNAYVMIGAANGHIKDNWGNSDNKTAFAYGAGIQLNPVENIAVNASYEHTSFSTDADSDVKAGT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,086,176 | -5.92 | 6.7e-5 | ●●●○○ -2.9 | -2.89605160938168 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,086,190 | -4.82 | 6.7e-14 | ●●●○○ -2.33 | -2.32775654838854 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,086,190 | -3.75 | 0.00052 | ●●○○○ -1.77 | -1.76917760931029 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,086,190 | -2.28 | 0.042 | ●●○○○ -1 | -1.00499137137649 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,086,176 | -2.19 | 1.3e-5 | ●○○○○ -0.96 | -0.959738372671634 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,086,176 | -0.68 | 0.89 | ●○○○○ -0.18 | -0.176956478363566 | 23637626 |
Retrieved 6 of 6 entries in 0.7 ms
(Link to these results)