Bacterial taxon 909946
Locus STM474_2911
Protein WP_000274378.1
alpha/beta hydrolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 311 aa, Gene iroE, UniProt E8XK18
>WP_000274378.1|Salmonella enterica Serovar Typhimurium ST4 74|alpha/beta hydrolase
MYGRQYHNKRYRMALFLVSFCFSALSYAQPDMQPLGPNIADKGSGYYHFRVNDFQSADGARHYRVWTAIPNKAAPPSGYPVLYMLDGNAVMDRLPETLLKQLADHSPPVIVAIGYQTNLPFDLNGRAYDYTPAPGIDRDDSENNPRFHRKTGGGPAFRQLLERHIAPQVEQGITINSERRGVWGHSYGGLFVLDSWLSSSFFHIYYSASPSLSRDNFVLLNRLTTVKPSLFCHKKLIIMEGSASNGDSRQRQMAELLQKVQETVRTLENNGVNAALQHYPGLGHGPMFNASFRSALLDISREPASQKPRCH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,946,028 | -4.24 | 4.4e-6 | ●●●○○ -2.02 | -2.02443171292986 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,946,028 | -4.12 | 2.6e-14 | ●●○○○ -1.96 | -1.9644775994096 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,945,970 | 2.59 | 0.033 | ○○○○○ 1.52 | 1.52288107976321 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,946,028 | -1.84 | 0.14 | ●○○○○ -0.78 | -0.777156566304941 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,945,970 | -0.01 | 1 | ○○○○○ 0.17 | 0.171644466343753 | 23637626 |
Retrieved 5 of 5 entries in 0.9 ms
(Link to these results)