Bacterial taxon 909946
Locus STM474_3576
Protein WP_001682446.1
alternative ribosome-rescue factor A
Salmonella enterica Serovar Typhimurium ST4 74
Length 89 aa, Gene n/a, UniProt E8XDV5
>WP_001682446.1|Salmonella enterica Serovar Typhimurium ST4 74|alternative ribosome-rescue factor A
MSRYQHKKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYLRKGKHGNRGNWEASGKKVNHFFTTGLLLIKNGYFVLSADRGFRPITLPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,603,252 | 1.01 | 0.72 | ○○○○○ 0.7 | 0.703861677284686 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,603,252 | 1.98 | 0.61 | ○○○○○ 1.2 | 1.2037295117124 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)