Bacterial taxon 909946
Locus STM474_0249
Protein WP_000560527.1
aminoacyl-tRNA hydrolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 140 aa, Gene yaej, UniProt E8XIR0
>WP_000560527.1|Salmonella enterica Serovar Typhimurium ST4 74|aminoacyl-tRNA hydrolase
MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRASGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 281,590 | -0.7 | 0.73 | ●○○○○ -0.19 | -0.188885987136287 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 281,257 | -0.22 | 0.95 | ○○○○○ 0.06 | 0.0640286659765712 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 281,257 | 0.18 | 0.82 | ○○○○○ 0.27 | 0.269282175965018 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 281,257 | 0.59 | 0.72 | ○○○○○ 0.48 | 0.482708018662495 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 281,342 | 0.69 | 0.21 | ○○○○○ 0.53 | 0.534768426363109 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 281,590 | 0.72 | 0.85 | ○○○○○ 0.55 | 0.548623933226285 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 281,342 | 1.11 | 0.66 | ○○○○○ 0.75 | 0.754596564795909 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 281,590 | 1.13 | 0.07 | ○○○○○ 0.77 | 0.765320491191637 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 281,342 | 1.23 | 0.32 | ○○○○○ 0.82 | 0.817313459124455 | 23637626 |
Retrieved 9 of 9 entries in 1.9 ms
(Link to these results)